PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 284aa    MW: 31968.8 Da    PI: 5.6747
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2590genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.97.8e-12155201551
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L++e ++L  ++  
  Gh_A11G2590 155 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSTLSPRVAF 201
                  899***********************************999877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-14151215IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.714153205IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-12155207No hitNo description
SuperFamilySSF579595.13E-12155209No hitNo description
PfamPF001703.2E-10155200IPR004827Basic-leucine zipper domain
CDDcd147031.05E-22156206No hitNo description
PROSITE patternPS000360158173IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MPTMANFISS STTSTMMKDS NHQNHHQPSW ADEFLDFSSM RRGAQRRSMS DFIAFIDQPL  60
EEENRAGNAM MMEPNMFDRL DDEQLKSMFS NDVSLTMPAA TMGSSSSTPL MSDQNSNNDE  120
KPTPGEVESS YKLHETQGSE PPSTSNGGDP ITDPKRVKRI LANRQSAQRS RVRKLQYISE  180
LERSVTTLQT EVSTLSPRVA FLDHQRVVLT VENGALKQRI AALAQDKIFK DAHQEALKKE  240
IERLTQVYQQ QQSLKNMNDN PLPPPPQQQQ PLLPPPPNEG QLIS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488308.10.0PREDICTED: basic leucine zipper 34-like
SwissprotQ9M2K48e-81BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A0D2TQI10.0A0A0D2TQI1_G
STRINGVIT_19s0014g01780.t012e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.17e-82bZIP family protein